PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0086s00350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 255aa    MW: 28959.5 Da    PI: 9.3331
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0086s00350.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.91.6e-39128205178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +Cq+e+C+adl eak+yhrrhkvCe h++a+vvlv+g++qrfCqqCsrfhelsefD++krsCrrrLa hnerrrk+++
  Vradi0086s00350.1 128 CCQAEKCNADLHEAKQYHRRHKVCESHAEAQVVLVHGTKQRFCQQCSRFHELSEFDDAKRSCRRRLAVHNERRRKNSS 205
                        6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-31126190IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.983126203IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-36127206IPR004333Transcription factor, SBP-box
PfamPF031106.4E-31129202IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MNGGASYSEE AHSGRDEARR NLRQRLSADM LRLNEPHKNI IVYSPVTTVT IPPLYHNSHT  60
PSPLFNDSTC HSSMEGLEPK VVVRGERLKR DVDCGDNQKG YVELRQENKK KKKGEGGKKG  120
CVDGGMLCCQ AEKCNADLHE AKQYHRRHKV CESHAEAQVV LVHGTKQRFC QQCSRFHELS  180
EFDDAKRSCR RRLAVHNERR RKNSSDQSQA EGSRHHKGSE VPQMKDIACG QANERGRTHI  240
TIQENSAYKK FEIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-33125202784squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108118KKKKKGEGGKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-149AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491715.11e-130PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_014491716.11e-130PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ9S7A92e-39SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A0L9UMD81e-126A0A0L9UMD8_PHAAN; Uncharacterized protein
STRINGGLYMA13G37130.12e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.25e-40squamosa promoter binding protein-like 4